Digital marketing jobs in google india. Leverage your professional network, and get hired.
Digital marketing jobs in google india Google Gurugram, Haryana, India. com) Bengaluru May 10, 2023 · According to LinkedIn, more than 32,000 digital marketing jobs are available in India. Check your eligibility, salary, location and apply at various Digital Marketing job openings in top companies! Experience: Minimum of 3 years of experience in digital marketing, with a proven track record of managing performance marketing campaigns across Google, Meta, and other digital platforms. Digital Marketing Manager; PPC Manager; Social Media Marketer; Brand Manager; Visual Designer Dec 27, 2024 · Digital Marketing Jobs in India FAQs. Look at how JIO penetrates the market as Airtel reduces prices. Oct 22, 2024 · Google has opened applications for its highly anticipated Digital Business Marketing Apprenticeship, offering a golden opportunity for aspiring digital marketers to gain hands-on experience. On-time project delivery. Posted Posted 1 day ago Experience using Google Analytics, Google Search Console, SEMrush, or other digital marketing tools. This apprenticeship is intended for candidates who have completed their university degree and are looking to kick start their Today’s top 299 Digital Marketing Entry Level jobs in India. Business interns come from all backgrounds, bring their diverse talents to drive the business, grow our people, and Google Hyderabad, Telangana, India. In this role, you will gain valuable hands-on experience in various aspects of digital marketing, including social media management, content creation, SEO, and paid advertising: - Stay updated on the latest digital marketing trends and tools to continuously improve campaign performance. Employer Active 4 days ago Develop and execute digital marketing campaigns on Google Ads. To learn and explore more about scope of digital marketing and Digital Marketing careers in India, Click here. New Digital Marketing Entry Level jobs added daily. Today’s top 2,000+ Digital Marketing jobs in Hyderabad, Telangana, India. - Strong analytical skills with the ability to interpret data and make informed decisions. We are always looking for talented professionals who want to keep learning, and work with us towards achieving our company goals. Search Digital marketing fresher jobs in India with company ratings & salaries. Skills: Landing pages, Website management, Content generation. At an agency, these roles work with Nov 14, 2024 · The estimated total pay range for a Digital Marketing Strategist at Google is ₹17. PPC managers are expected to handle various ad types, such as Google Display, Bing ads, and other paid search engine advertising. Dec 11, 2024 · The estimated total pay range for a Digital Marketing at Google is ₹400K–₹437K per year, which includes base salary and additional pay. Collaborate with the sales team to align digital marketing campaigns with sales objectives and lead-generation Job Title: Digital Marketing Intern Department: Marketing. Few years back, digital marketing jobs in India were far from mainstream. Employer Active 3 days ago · More View all Educohire jobs - Surat, Gujarat jobs - Marketing Executive jobs in Surat, Gujarat 6,829 Fresher Digital Marketing jobs available on Indeed. How does the salary as a Digital Marketing at Google compare with the base salary range for this job? The average salary for a Digital Marketing is $82,937 per year (estimate) in United States , which is Infinity% higher than the average Google salary of $0 per year (estimate) for this job. Furthermore, use of the internet to drive brand awareness continues to displace print advertising. Get details on salary, company and location. Job Description: We are looking for a highly capable Digital Marketing executive to manage and generate digital leads from various online marketing platforms by running Google Ads and analyze lead flow quality from Various platforms. Website promotion for both Local & Global regions. Ltd. Find Digital Marketing Jobs in India. . Today’s top 3,000+ Marketing Digital jobs in Thane, Maharashtra, India. Explore Digital Marketing Openings Across Top Companies Now! Today’s top 4,000+ Digital Marketing jobs in Navi Mumbai, Maharashtra, India. Today’s top 496 Digital Marketing jobs in Surat, Gujarat, India. We are seeking a highly motivated and creative Digital Marketing Intern to join our growing team. As part of our team, you will help drive digital marketing campaigns, create SEO-friendly content, design visuals, and produce videos to enhance our brand's visibility in the education space. Today’s top 189 Digital Marketing jobs in Bhubaneshwar, Odisha, India. 0 Lakhs per year Dec 28, 2024 - Find 515 Digital Marketing Job Openings in Delhi on Jobhai. Digital Marketing Managers are responsible for developing, implementing, and managing marketing campaigns that promote a company’s products or services. 9 Lakhs to ₹12. Microsoft. 16,779 open jobs for Digital marketing in India. Oct 5, 2024 · Top Highest-Paying Digital Marketing Jobs. Digital Marketing People who searched for jobs in India also searched for digital marketing strategist, director of digital marketing and seo, digital media, digital media content coordinator, digital marketing assistant, digital marketing head, digital media consultant, digital marketing coordinator, digital media coordinator, digital marketing analyst. Employer Active 2 days ago · More View all Prompt Equipment Pvt. Key Responsibilities: Digital Marketing: Develop and execute digital marketing strategies to promote educational programs, courses, and services. Job Type: Full-time. Google PPC & Meta Ads Experience. Pay-Per-Click Managers. Below is the list of top 10 highest-paying digital marketing jobs: 1. I work for a brand ( not a digital marketing agency) so let me give a shot. 9. Careers at Digitz . On Indeed, you can find over 17,000 digital marketing jobs with high pay in India. · More View all Inarrch Technologies jobs - Nagpur, Maharashtra jobs - Senior Digital Marketing Executive jobs in Nagpur, Maharashtra Mar 22, 2024 · One of the best digital marketing courses in India, is Digital Scholar’s online digital marketing course. The two-year program, available in major cities across India, aims to equip recent graduates and career changers with cutting-edge skills in digital marketing. Experience: 3+ years in Marketing and Content. Amazon, TCS, Google, and Accenture are currently the companies that offer the highest Digital Marketing salary i. Location: Near Noida Sector 15 Metro Station Tenure: 6 Months. Digital Marketing Strategist, gTech Ads Google Customer Solutions Get email updates for new Digital Marketing Strategist jobs Today’s top 8,000+ Digital Marketing Analyst jobs in India. 5. As government agencies increasingly rely on digital marketing to communicate with citizens and deliver services, the demand for experts in this field will only grow. You can find digital marketing job openings based on the profile you are interested in, preferred work mode, and experience level. Marketing jobs at Google. INR 18,000 - 80,000 BBA in Digital Marketing jobs in India are available in both government and private sector in diverse Job Title: Senior Digital Marketing Specialist. 6,454 Digital Marketing Fresher jobs available on Indeed. The Digital marketing executive is responsible for planning social media calendars, creating social media posts, and assisting the digital marketing team. New Digital. Digital Marketing Strategist salary at Google in India ranges between ₹14. We are seeking a skilled and experienced Digital Marketing Specialist to join our team in Calicut, India. Work policy and location: This is a remote position, but we value in-person collaboration and occasional team gatherings. Google Hyderabad, Telangana, India Actively Hiring Company website: https://sumtracker. Feb 12, 2024 · FAQs for Digital Marketing Career in India. Experience in managing and optimizing paid advertising campaigns. 1. As an industry, it attracts both young graduates and seasoned professionals and offers many employment Experience in selling integrated digital marketing services (websites, affiliate marketing services, SEO, social media, content marketing, creative, etc. However, the salary range would differ based on the location, qualification and years of experience. May 19, 2024 · Google. Marketing Executives manage various aspects of marketing. Companies are jumping on to digital marketing because of ease of calculation of ROI. Create and optimise digital marketing campaigns on platforms like Google Ads, Facebook. Join to apply for the Digital Marketing Strategist, Customer Success Acceleration role at Google. including advertising, digital marketing, social media, and public relations. Find the latest Digital Marketing job vacancies and employment opportunities in India. Posted 12:00:00 AM. New Amazon Digital Marketing jobs added daily. Reasons to hire us as the best digital marketing agency: 550+ Verified Reviews with 4. … 63 Digital Marketing jobs available in Patna, Bihar on Indeed. ). New Google Digital Marketing Manager jobs added daily. Check out remote, part time, and fresher jobs in digital marketing. New Google Marketing jobs added daily. These marketing professionals enhance PPC campaigns using budgeting, keyword selection, copy improvement, comprehensive search strategies, etc. View all Google jobs - Gurugram, This role is 100% remote for residents of India. 9/5 Rating 26% Repeat Hire Rate Preferred Freelancer 100% White Hat SEO strategies. 3 Lakhs per year; Globant Digital Marketing Specialist Salary - ₹6. – An intelligent accumulation of essential details regarding digital marketing by India’s leading digital marketing experts, Sorav Jain. Google Hyderabad, Telangana, India. Digital Media Managers Implement digital marketing activities across a broad range of digital marketing channels (SEO, SEM, Social Media, Email, Mobile, Display). Location: Indore, India. jobs - Gurugram, Haryana jobs - Digital Marketer jobs in Gurugram, Haryana Experience with digital marketing tools such as Google Analytics, Google AdWords, etc. Start-up or Agency: By learning digital marketing skills, you can be capable enough to start your own agency/start-up. com, India's No. 1 Job Portal. Sep 28, 2024 · For example, Google’s digital marketing strategist earns up to ₹ 27,95,948 per year which is 459% more than the average Digital Marketing Strategist Salary in Internet Companies Skillset and Expertise Our interns are a part of Google—involved and solving problems from the start. Browse Digital Marketing Jobs and apply today! 50+ Remote Digital Marketing Jobs in India. In this role, View all MCI GeTS India Pvt Ltd jobs - Delhi, Delhi jobs; Developandexecute digital marketing campaigns across various channels such as social media, email marketing, SEO/SEM, content marketing, and paid advertising. 5,361 Digital Marketing Partner jobs available on Indeed. New Google Marketing And Sales jobs added daily. Digitz is one of the leading and fastest growing web designing and online marketing companies in India. Dec 5, 2024 · Digital Marketing Career Opportunities in India for 2025 . marketing jobs added daily. There are many types of roles within digital marketing and e-commerce in organizations of all sizes, across most all industries. New Digital Marketing jobs added daily. New Google jobs added daily. Employer Active 2 days ago · More View all Crecer Inteligente jobs - Hyderabad, Telangana jobs - Digital Marketing Manager jobs in Hyderabad, Telangana Check out the latest 65 Digital Marketing Jobs Vacancies in India by Hamara Jobs. Use this list as a model to help guide your research process. Deep knowledge of digital marketing across social, display, and programmatic platforms. What is the job outlook for Digital Marketing Managers? Powered by Glassdoor Economic Research. Search for Digital Marketing Jobs: Use the search bar to look for job openings specifically related to digital marketing in Kolkata. Entry-level digital marketing jobs. com. Salary estimates are based on 72 latest salaries received from various employees of Google India. Skip to main content. The average additional pay is ₹0 per year, which could include cash bonus, stock, commission, profit sharing or tips. Growing a Dec 30, 2024 - Find 135 Digital Marketing Job Openings in Bangalore on Jobhai. On the other hand, if you are in search of the best digital marketing jobs in India, salary is not the only aspect to consider. 4L per year. → Digital Marketing Jobs in Naukri: Digital marketing jobs in Naukri for the last 30 days is 18,686 Get started in the high-growth fields of digital marketing and e-commerce with a professional certificate from Google. Job type. Full-time (66) Internship (35) Fresher (12) Part-time (5) Today’s top 194 Google jobs in Kochi, Kerala, India. New Digital Marketing Expert jobs added daily. India Digital Marketing jobs. Filter Results: Narrow down your search results by filtering based on job type, job duration, and other relevant factors to find roles that align with your interests and expertise. Q5. Skills:SEO, SEM, Social Media Marketing, Content Marketing, Email Marketing, Digital Strategy…See this and similar jobs on LinkedIn. 0 Lakhs per year; IBM Digital Marketing Specialist Salary - ₹11. Digital marketing jobs are growing at an exponential rate & with new technologies coming into practice in everyday business, the role of digital marketers is immense. Some of the digital marketing courses with 100 placement guarantees in 2025 are:- Digital Marketing Manager: A digital marketing manager helps to organize and Today’s top 7,000+ Digital Marketing jobs in Gurugram, Haryana, India. New Associate Digital Marketing jobs added daily. Google Operations Center Hyderabad, Telangana Nov 22, 2023 · Had this been 2020, you would have laughed at me for writing a blog on Digital Marketing Job Opportunities in India. Find your next job at Google — Careers at Google. May 16, 2024 · Highest Paid Jobs in Digital Marketing in 2025. Apply now to over 670 Digital Marketing jobs in India and make your job hunting simpler. 5L per year, which includes base salary and additional pay. It is also an entry-level job in the digital marketing field. What is the salary of a digital marketing fresher in India? Nov 22, 2020 · The report also suggests that digital marketing jobs are growing by an average of 14% providing more than 20 lakh jobs. Search by location, role, skills, and more. Learn about marketing and communications at Google. Below are some of the top digital marketing jobs offering high salaries and good work environments to individuals-1. Get email updates for new Digital Marketing Manager jobs in India. Today’s top 6,000+ Google Marketing jobs in India. Today’s top 1,000+ Google Marketing And Sales jobs in India. Strong understanding of digital marketing channels and tactics, including social media, email marketing, search engine optimization (SEO), search engine marketing (SEM), and display advertising Work on all core marketing disciplines including web-based content, content marketing, print, digital, social media, direct marketing, and promotional marketing… Employer Active 9 days ago Global Graduate - Marketing Find the best Digital Marketing jobs in India in 2025! Apply to all of them with a single profile and get in touch with hiring managers directly on Wellfound. Today’s top 7,000+ Google Digital Marketing jobs in India. Q1. 3L–₹38. Do check them out if you want to kick start your journey and become an expert digital marketer. People who searched for jobs in India also searched for game marketing, digital marketing intern, digital marketing internship, online marketing intern, digital media intern, digital media production, digital media internship, video game marketing, associate digital producer. Today’s top 103 Google jobs in Lucknow, Uttar Pradesh, India. 0 Lakhs to ₹37. We have listed 10 digital marketing highest salary jobs in India that you can explore. Roles like digital marketing manager, SEO specialist, content marketing strategist, and data analyst are among the most sought-after and well-paid positions. 8 Lakhs to ₹53. Dec 27, 2024 · I have a list of Digital Marketing Agencies in India, you can probably have a look and categorize this for yourself. They can serve as part of your journey to a meaningful career. How to make a digital marketing career Oct 10, 2024 · Below is the list of top 10 highest-paying marketing jobs: 1. Nov 15, 2024 · Enrolling in an accredited digital marketing course will help you build the skills necessary for digital marketing job opportunities in India. Analytical Skills: Strong proficiency in web analytics tools (e. Ltd jobs - Ahmedabad, Gujarat jobs - Senior Digital Marketer jobs in Ahmedabad, Gujarat Today’s top 717 Associate Digital Marketing jobs in Gurgaon, Haryana, India. *Digital Marketing Knowledge*: Understanding of digital marketing principles, including SEO, social media, email marketing, and content marketing. g. com | Free Registration & Apply to Latest Verified Digital Marketing Jobs in Bangalore | Call HR Directly for Interview Support product marketing strategy, understanding the users and turning them into a loyal consumer base and shaping the voice of the Google brand, or designing and executing digital marketing campaigns for the biggest brand marketers in the world, you will get exposure to different Google products. New Google Mba Marketing jobs added daily. 8 Lakhs to ₹15. Today’s top 400 Google Digital Marketing jobs in Hyderabad, Telangana, India. Demand for digital marketing managers is growing significantly, with the increase of ecommerce and financial technology companies. The average Digital Marketing base salary at Google is ₹418K per year. In-depth knowledge of SEO, SEM, Google Analytics, and other digital marketing tools. According to our estimates it is 96% more than the average Digital Marketing Strategist Salary in India. Get email updates for new Digital Marketing Strategist jobs in Gurugram, Haryana, India. Advantages: Why join a coaching course for Digital Marketing when you learn while you earn. 657 Digital Marketing jobs available in Remote on Indeed. Employment Type: Full time. During the program, apprentices get exposure to different areas and teams at Google, while receiving external training and developing their professional skills on the job. Posted 12:32:56 PM. View all QMS India jobs - Mumbai, Maharashtra jobs - Digital Marketing Executive jobs in Mumbai, Maharashtra; Salary Search: Digital Marketing Executive - SEO & Google Analytics / Ads - Vile Parle salaries in Mumbai, Maharashtra Apprenticeships contribute towards the development of digital skills by providing opportunities for work and study. The social media manager is the most in-demand digital marketing job in 2022. Conduct market research to identify trends, competitor activities, and new opportunities in digital marketing. Learn to manage digital marketing campaigns, attract and engage customers, and sell products online. The Google Digital Marketing & E-commerce Certificate can qualify you for in-demand digital marketing jobs such as digital marketer and e-commerce specialist. Pay Today’s top 7,000+ Digital Marketing jobs in Gurgaon, Haryana, India. Digital Marketing Specialist Proficiency in digital marketing tools such as Google Analytics, Meta Business Suite, Google Ads, etc. , Google Analytics, Google Data Studio) and the ability to interpret data and translate it Today’s top 278 Google Mba Marketing jobs in India. 1 Lakhs to ₹12. Today’s top 1,000+ Google Digital Marketing Manager jobs in India. *Collaborative Mindset*: Ability to work collaboratively with designers, art directors, and account managers to deliver cohesive campaigns. Digital Marketing Manager. Today’s top 1,000+ Digital Marketing Fresher jobs in India. The future of digital marketing courses offers various roles and career opportunities for professionals with diverse skill sets. Employer Active 6 days ago How to Get a Digital Marketing Job at Google? While digital marketing is becoming a fast paced flourishing industry and career choice of people across the world, Google does have a kind of “monopoly” in the domain of digital marketing. What are the job opportunities in digital marketing in India? India offers abundant digital marketing job opportunities due to the rise in internet penetration and businesses shifting online. Social Media Manager. Collaboration with Sales and Operations. Salay for any digital marketing role depends on various factors, such as the job location, company, work experience, etc. New Google Digital Marketing jobs added daily. Salary estimates are based on 20 latest salaries received from various employees of Google India. Experience in implementing, optimizing and managing digital advertising campaigns, as well as managing complex, transformative solutions with clients. Sort by: relevance - date. Experience with Google Analytics, Google Ads, Flexi Management Consultancy India Private Limted. Are digital marketing jobs in demand? Ans. 0 Lakhs for less than 1 year of experience to 7 years. 0 Lakhs to ₹15. 3 Lakhs per year; VMware Software Digital Marketing Specialist Salary - ₹4. New Digital Marketing Training jobs added daily. Google Digital Marketing Apprenticeship for the year 2022 has been launched by Google India. What they earn Today's top 42,000+ Digital. Top companies hiring Digital Marketing Manager jobs near you in India include Accenture with an Apply To 180423 Digital Marketing Jobs On Naukri. If you're getting few results, try a more general search term. Strong analytical, problem-solving, and communication skills. Ltd jobs - Vadodara, Gujarat jobs - Marketing Manager jobs in Vadodara, Gujarat Hi, digital marketer here. Today’s top 8 Google Internship 2025 jobs in India. One-stop solution for your all-digital marketing problems. What are the top 2 highest paying digital marketing jobs in India? Chief marketing and product marketing managers are India’s top 2 highest paying digital marketing jobs. Looking for potential INTERNS who want to pursue their career in Digital Marketing. Today’s top 511 Digital Marketing Expert jobs in Bengaluru, Karnataka, India. Stay updated on the latest digital marketing trends, tools, and best practices. Job Types: Full-time, Part-time. Digital marketing assistant. 5 Lakh jobs within India and for that various digital marketing courses (which provide online courses as well) and digital marketing agencies are available. May 15, 2024 · Which job role is best in digital marketing? Answer: The “best” job role in digital marketing depends on an individual’s interests, skills, and career goals. Nov 29, 2023 · For each digital marketing career, we’ve included the average salary in India, typical responsibilities, and qualifications based on information from Glassdoor and Naukri as of February 2023. India’s growing digital penetration and e-commerce boom have created an ever-increasing demand for qualified Digital Marketing professionals. Digital Marketing: Oversee SEO, social media, email marketing, and other digital platforms. 5+ years of hands-on experience in digital marketing,… Employer Active 4 days ago · More Digital Marketing and AI Trends: Explore and implement the latest digital marketing and AI tools to enhance marketing effectiveness, streamline workflows, and… Employer Active 5 days ago · More View all Wattmonk Renewable Technologies Inc. 6,479 open jobs for Digital marketing fresher in India. Certification in digital marketing (Google Hiring a Web3 Digital Marketing Specialist - INDIA Apr 26, 2024 · Times of India has reported that by 2022, Digital Marketing would generate 2. In this role, you will gain valuable hands-on experience in various aspects of digital marketing, including social media management, content creation, SEO, and paid advertising: Nov 18, 2021 · Hey Marketers! We are excited to share some amazing news if you’re looking for a job in the field of Digital Marketing. INR 2,00,000 – 10,00,000 per annum for different digital marketing job roles. 98 Google Digital Marketing Certificate jobs available on Indeed. Digital Marketing Cubic Logics (apps365. Here are are the different salary structure for digital marketing professionals in India: Digital Marketing Intern: 10,000 – 15,000 INR/Month Today’s top 10,000+ Digital Marketing Training jobs in India. 6,009 jobs. Internship Opportunities open at Cokion: Designation will be as per your experience and caliber. Aug 24, 2024 · Digital Marketing Manager salary at Google in India ranges between ₹9. MBA in Digital Marketing scope in India is high, and the average salary is INR 3 - 12 LPA. Proven track record of increasing organic traffic and improving SEO rankings for websites. Apply quickly to various Digital Marketing jobs . Employer Active 4 days ago · More View all Infedis Infotech LLP jobs - Pune, Maharashtra jobs - Senior Digital Marketing Executive jobs in Pune, Maharashtra Digital marketing utilizes online channels and digital technologies to promote products, services, and brands, encompassing activities such as search engine optimization, social media marketing, pay-per-click advertising, content marketing, email marketing, and 1 online advertising. The average Digital Marketing Strategist base salary at Google is ₹22. Oct 26, 2021 · Let us now dive into the top 10 digital marketing jobs for freshers in 2021. Digital Marketing Strategist. Work usually involves getting in leads. Today’s top 3,000+ Digital Marketing Manager jobs in India. Job Summary: We are seeking a highly skilled and motivated Senior Digital Marketing Specialist to lead, develop and execute our B2B digital marketing initiatives and enhance lead generation efforts. Employer Active 2 days ago · More View all Active India employment services Pvt. Certification in Google Ads or SEO (preferred). I work with our digital marketing agency to do usual SEO/SMO and social media campaigns. What are the expectations on the Digital Marketing job roles? – It Differs in An Agency: I run an agency called echoVME which is one of the oldest Digital Marketing agencies of India. Aug 16, 2019 · The following data from the top job portals in India shows the enormous scope for digital marketing in the country. Today’s top 79 Digital Marketing Strategist jobs in India. Leverage your professional network, and get hired. Apply Join or sign in to find your next job. 11. Improve your site health to look better 17,253 Digital Marketing jobs available in India on Indeed. com | Free Registration & Apply to Latest Verified Digital Marketing Jobs in Delhi | Call HR Directly for Interview Digital marketing: 1 year (Required). Check out latest 1947 Digital Marketing job vacancies in India. 6 days ago · Highest-Paying Digital Marketing Jobs In India. Job designation for MBA in Digital Marketing jobs for freshers: Digital Marketing Manager; Digital Marketing Executive People who searched for jobs in India also searched for remote assistant, performance marketer remote, metrics manager, enterprise marketing, digital marketing specialist, marketing project manager, vp of marketing, head of marketing. They focus on improving brand visibility, traffic, and engagement. If you are passionate about digital marketing, possess a proven track record of working with diverse clients across niches (B2B, B2C, and SaaS), and have experience in GCC and Indian markets, we’d love to hear from you! digital marketing india jobs. Proficiency in using digital marketing tools, including Google Ads Mar 4, 2024 · Source. Expert-level proficiency in Google AdWords,other digital marketing tools. Freshworks Digital Marketing Specialist Salary - ₹9. e. (Google Ads, social media, email marketing, Technix India solutions Pvt. 2 days ago · 04 Jan, 2025 - Looking for ⭐ best Online Marketing jobs? Apply for latest jobs ️ Free Registration ️ Instant access to Employer ️Free Phone numbers. Job Title: Digital Marketing Intern Department: Marketing. Qualifications: - 1 to 2 years of experience in digital marketing with a focus on Google Ads, Meta Ads, and App Promotion. Develop the skills for a career in digital marketing and sales while empowering small businesses with the Spark at Google program. 2. Brand Manager. Extensive experience with at least one digital acquisition channel, including app campaigns on Google and Facebook. According to our estimates it is 92% more than the average Digital Marketing Manager Salary in India. Digital marketing is considered as one of the most in-demand fields among youth. Experience managing Insights, Analytics, Monitoring and analyzing digital media and marketing trends. marketing jobs in India. New Digital Marketing Fresher jobs added daily. Oversee the creation and execution of all marketing initiatives, including digital marketing, content marketing, social media, and events. Indian companies were stuck with traditional marketing practices and were not ready to change. This indicates that digital marketing is a good career with high-paying jobs and multiple job opportunities. Today’s top 426 Google Digital Marketing jobs in Pune, Maharashtra, India. Feb 15, 2024 · Career Opportunities in Digital Marketing Government Jobs in India Government jobs in digital marketing offer an exciting and stable career path in a continuously evolving sector. · More View all 3 Minds Digital jobs - Gurugram, Haryana jobs Sep 19, 2022 · Now that we know digital marketing is super important, let's have a look at all the top digital marketing jobs available in 2022 and beyond. Clear text. Brand Managers are responsible for developing and implementing marketing strategies that improve brand awareness and customer loyalty. Role OverviewThe Digital Marketing Executive will be responsible for developing, implementing, and…See this and similar jobs on LinkedIn. INR 21,000 - 66,000. Exceptional communication and interpersonal skills. Search Digital marketing jobs in India with company ratings & salaries. Today's top 36,000+ Digital Marketing jobs in India. New Marketing Digital jobs added daily. Mastery of digital marketing tools and platforms such as Google Ads, Bing Ads, and programmatic advertising… Employer Active 6 days ago · More View all Cloudstaff jobs - Bengaluru, Karnataka jobs - Digital Marketer jobs in Bengaluru, Karnataka Start your job search by exploring top-rated companies with Digital Marketing Manager job openings near you! Company ratings are based on anonymous employee reviews to give you a candid look at what makes these the top companies to work for in India. New Digital Marketing Manager jobs added daily. Today’s top 1,000+ Google Digital Marketing jobs in Gurugram, Haryana, India. If you Digital marketing is electronic marketing where they advertise and promote their products on social media, emails, websites and much more. Salary Structure For Digital Marketing Professionals in India. Today’s top 990 Amazon Digital Marketing jobs in India. Strong understanding of digital campaign management principles, including planning, execution, tracking & analysis. 0 Lakhs for experience between 1 years to 7 years. bqwifjnxdtrodawmwnlklytwpkrnatcsisdspsstgqturnfqjxdgd